PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A02G1659
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 227aa    MW: 25119 Da    PI: 10.2041
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A02G1659genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1482.7e-15157207454
                  XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                  ++r +r++kNRe+A rsR+RK+a++ eLe +v+ L +eN +L+ e e+l+ 
  Gh_A02G1659 157 DRRHKRMIKNRESAARSRARKQAYTNELELEVAHLMEENAKLRREQEQLQV 207
                  689********************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-12154218IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.473156206IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.8E-14158207No hitNo description
CDDcd147075.69E-30158212No hitNo description
PfamPF001707.3E-14158206IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.5E-11158206No hitNo description
PROSITE patternPS000360161176IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000028Biological Processregulation of photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MLSPSNKPQI TPLKPSSPPP PHRPKTMEEV WNDITLASLH DHHSSSSSSR EPFSSNPHLI  60
LQDFLAARSD PPPSQQQTNG GGDTNTMLYG SPLPPPATVL SLNSGPGFDF LDNPRLQSSP  120
ISTLPTFNSP FEALASSTTL ATFGKKRTQD SDNNSGDRRH KRMIKNRESA ARSRARKQAY  180
TNELELEVAH LMEENAKLRR EQEQLQVAAT AQLSRNRMLQ RTSTAPF
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6154370.0JX615437.1 Gossypium hirsutum clone NBRI_GE59423 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012469288.11e-137PREDICTED: protein FD-like
SwissprotQ84JK25e-70FD_ARATH; Protein FD
TrEMBLA0A0D2QL661e-137A0A0D2QL66_G
STRINGAT4G35900.11e-67(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19342772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.17e-68bZIP family protein